NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007730

3300007730: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_RNA CLC_assembly



Overview

Basic Information
IMG/M Taxon OID3300007730 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111355 | Gp0128094 | Ga0105669
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_RNA CLC_assembly
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size9055717
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationAxial Seamount, northeast Pacific Ocean
CoordinatesLat. (o)45.9372Long. (o)-130.082Alt. (m)N/ADepth (m)1500
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008173Metatranscriptome337Y
F021318Metagenome / Metatranscriptome219Y
F098669Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0105669_106255Not Available515Open in IMG/M
Ga0105669_109568Not Available984Open in IMG/M
Ga0105669_112545Not Available581Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0105669_106255Ga0105669_1062551F098669METATRSRKQKWRLKEAEGLGRKRRVEEAERRELHESDQGLDPGHGLNPGRKVRRIDQAMEGSPEIVPAKI
Ga0105669_109568Ga0105669_1095681F021318MQAKINKREIDYKGQQLWLNPVDKTVYATDGAPTYSFGEVNGTPIYNYNTHFDAVKTAKSDKLGTSYFHDAFVDPEFKSLAEDYVSAVKSGGRQRQAALRSSVNSAVDIVNVWETVLGKRDRVYAGKNLAKEVAVPNLLISIDTVTKFTGLEKLDEGMRARVKELPYTRSTFTAAKYGLKFIIHEEARLKNVHNVLQDSIQVASTKIEQRQSFDVIDVVETNTAQAAIAAWDTFVSSTTQSTGDPTIDIGIASLNIEGSGVGGRLNR
Ga0105669_112545Ga0105669_1125451F008173NEVENVVAEISERYGRFQDIECRQLKDTLVGIEDSGPGGAGRVRVSDFYKLAVDHGKWQFSESLDYLRNMGALDESDASKPSVIIPNYISGPSNCVASSGFYSVCCLDECEGILSRLEQFIAAPEASATQIAAFISNIPSATMPSNRKLSPWLHQRLDELDEHHKGRIPLHGRLFGQWMHYAYPRECAFPHIS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.