| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300007354 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114815 | Gp0115815 | Ga0104761 |
| Sample Name | Deep subsurface aquifer microbial community from Lead, South Dakota (SURF_DUSEL_B) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Aeronautics and Space Administration (NASA) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 279823141 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → unclassified Peptococcaceae → Peptococcaceae bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Sanford Underground Research Facility - Surf_Dusel_B |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Aquifer → Sanford Underground Research Facility - Surf_Dusel_B |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → aquifer → groundwater |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Lead, South Dakota, USA | |||||||
| Coordinates | Lat. (o) | -44.0341666 | Long. (o) | -103.765833 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021446 | Metagenome / Metatranscriptome | 219 | Y |
| F082184 | Metagenome | 113 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0104761_1013263 | All Organisms → cellular organisms → Bacteria | 2190 | Open in IMG/M |
| Ga0104761_1066418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → unclassified Peptococcaceae → Peptococcaceae bacterium | 807 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0104761_1013263 | Ga0104761_10132633 | F082184 | VDRKQAEAYAIHMLKFIRQEWPAAKPVSLEVGRDDKSEVLWCKIHRNEEDLTHGSGHLFTVAYLDREIVA* |
| Ga0104761_1066418 | Ga0104761_10664182 | F021446 | MKTLSIALMAAFMLVLAATSTGQAQNAEYRDLDPTVGGKYIYRGADYIAQTLIVRGDKLSEINELTLIIQIKGSPDFRVTFPLLAKRQEGNKLILDYQWYPGGDTYEATIIGGTLINRKTKGYLAGIREELFIRE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |