NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007282

3300007282: Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 4ppm of oxygen, sample C



Overview

Basic Information
IMG/M Taxon OID3300007282 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118053 | Gp0127447 | Ga0104350
Sample NameActivated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 4ppm of oxygen, sample C
Sequencing StatusPermanent Draft
Sequencing CenterXcelris labs Ltd
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size79695739
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium Pan2161
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameActivated Sludge Process Metagenomes
TypeEngineered
TaxonomyEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process → Activated Sludge Process Metagenomes

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationNagpur, India
CoordinatesLat. (o)21.1458004Long. (o)79.0881546Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049640Metagenome / Metatranscriptome146Y
F104576Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0104350_1048445All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium Pan2161298Open in IMG/M
Ga0104350_1088709Not Available520Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0104350_1048445Ga0104350_10484452F049640MEPRKIIVELLPHERAALLRGNFTSGEVREQLEASASSPHIKPITYTATDVNFLAGDLNHAIVKRGCRDADIIDLSARFDYVHDTINGSLDPWH*
Ga0104350_1088709Ga0104350_10887092F104576VLVDIEKCIDANRELAYDTGKETTEIDIVSIVTDEGLLKPFGVGEVTLQVRYQVL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.