| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300007218 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117937 | Gp0125972 | Ga0103964 |
| Sample Name | Pinova apple microbial communities from Italy |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Illumina |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 258270869 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Alternaria → Alternaria sect. Alternaria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Insights Gained From Metagenomic Shotgun Sequencing Of Apple Fruit Epiphytic Microbiota |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Plants → Phyllosphere → Carposphere → Unclassified → Fruit → Insights Gained From Metagenomic Shotgun Sequencing Of Apple Fruit Epiphytic Microbiota |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Italy | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049431 | Metagenome / Metatranscriptome | 146 | N |
| F088701 | Metagenome / Metatranscriptome | 109 | N |
| F102612 | Metagenome / Metatranscriptome | 101 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103964_1032604 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima | 1545 | Open in IMG/M |
| Ga0103964_1054821 | Not Available | 629 | Open in IMG/M |
| Ga0103964_1055831 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Alternaria → Alternaria sect. Alternaria | 8464 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103964_1032604 | Ga0103964_10326041 | F049431 | INQVTILSPSAEAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK* |
| Ga0103964_1054821 | Ga0103964_10548211 | F088701 | VAVVLKRPEKIPIPLFKXXXXXXXXXXXXIVALEYKIDLSRLSVMELDKSKKINDVINT* |
| Ga0103964_1055831 | Ga0103964_10558316 | F102612 | MSSPAQPSPQVLQAYHQRLETLYSSLPDLLTTEQEDKTGTEALEQDVGKLDVKEQNLEDRVNKYCQEFLYIGGPTPYKRDLTST* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |