| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300007205 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0103597 | Gp0123886 | Ga0099763 |
| Sample Name | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_T0_1 (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 64925959 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1 |
| Not Available | 3 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria |
| Type | Engineered |
| Taxonomy | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Austria: Klosterneuburg | |||||||
| Coordinates | Lat. (o) | 48.3 | Long. (o) | 16.2 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001758 | Metagenome / Metatranscriptome | 640 | Y |
| F009934 | Metagenome / Metatranscriptome | 311 | Y |
| F017318 | Metagenome / Metatranscriptome | 241 | Y |
| F070166 | Metatranscriptome | 123 | N |
| F090071 | Metagenome / Metatranscriptome | 108 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0099763_1188083 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 606 | Open in IMG/M |
| Ga0099763_1210983 | Not Available | 988 | Open in IMG/M |
| Ga0099763_1220681 | Not Available | 887 | Open in IMG/M |
| Ga0099763_1222958 | Not Available | 514 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0099763_1012771 | Ga0099763_10127711 | F001758 | SGQAGWRDSSQAGAQVPGAEAEFTSSSGEVRASSVHAKKELGDEER* |
| Ga0099763_1188083 | Ga0099763_11880831 | F090071 | NAADRALATRHAEAWYVATVLATGAASWALLTIARALTATTKETP* |
| Ga0099763_1210983 | Ga0099763_12109831 | F017318 | MGIPLLVVSLKFERTVEGLFDISCDGINPSVGLFNFSLSDLPNNSDFTNLFDMYRIDKIEVAWYPEYTVLSDSGLVSNAVDVQVNTAIAQISNTPTVVSDVLQYKTCVGTGITQIHKRSFQPSYLMDGICPCSCFLSCNNAIANWYGVAYGVAPTGTAMLFKSRAKFFMSFVQSR* |
| Ga0099763_1220681 | Ga0099763_12206811 | F070166 | LVSKIAYGKDFSLTELAALFHNQLWLQVKCETDVHFKEKFGGTLEALAKILKECNFSRGLQPGTISRMKAKVLALEGDFLIPQRNLPNLEAQLRNSITTKWRKQEGIEINKLPPKSFIGKGYRDHGTAPSPEIDGTPSWQEVGSEFSNLEREHTEAFLFLLKVIDNDPNVSIQERLQGLKRAIEVTERIKRIHPNWRNSQITEASKGRIIDAKKVKKVIP* |
| Ga0099763_1222958 | Ga0099763_12229581 | F009934 | MREPLDGPVMRPETPLAVENGVGKLAAYTAPNVSMGK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |