NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007080

3300007080: Ant gut microbial communities from Cephalotes clypeatus, Brazil



Overview

Basic Information
IMG/M Taxon OID3300007080 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117930 | Gp0125963 | Ga0102735
Sample NameAnt gut microbial communities from Cephalotes clypeatus, Brazil
Sequencing StatusPermanent Draft
Sequencing CenterHarvard University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size858913538
Sequencing Scaffolds0
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Gutless Worms Symbiont Microbial Communities From Various Locations
TypeHost-Associated
TaxonomyHost-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal proximal gut

Location Information
LocationBrazil: Uberlandia, State of Minas Gerais
CoordinatesLat. (o)42.8072Long. (o)-48.24Alt. (m)N/ADepth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054614Metagenome / Metatranscriptome139Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link

Sequences

Scaffold IDProtein IDFamilySequence
Ga0102735_1060975Ga0102735_10609751F054614MSLILTLTGRSNVLATTYFPAIDLSDGDYELGLMNFETYNTISNVNASNNKFYYDENDVEITIPEGSY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.