Basic Information | |
---|---|
IMG/M Taxon OID | 3300007080 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117930 | Gp0125963 | Ga0102735 |
Sample Name | Ant gut microbial communities from Cephalotes clypeatus, Brazil |
Sequencing Status | Permanent Draft |
Sequencing Center | Harvard University |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 858913538 |
Sequencing Scaffolds | 0 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
Type | Host-Associated |
Taxonomy | Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Brazil: Uberlandia, State of Minas Gerais | |||||||
Coordinates | Lat. (o) | 42.8072 | Long. (o) | -48.24 | Alt. (m) | N/A | Depth (m) | 6 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054614 | Metagenome / Metatranscriptome | 139 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0102735_1060975 | Ga0102735_10609751 | F054614 | MSLILTLTGRSNVLATTYFPAIDLSDGDYELGLMNFETYNTISNVNASNNKFYYDENDVEITIPEGSY |
⦗Top⦘ |