NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007058

3300007058: Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut



Overview

Basic Information
IMG/M Taxon OID3300007058 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114771 | Gp0126732 | Ga0104043
Sample NameDrosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut
Sequencing StatusPermanent Draft
Sequencing CenterCornell University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size55383107
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDrosophila Gut Microbial Communities From New York, Usa
TypeHost-Associated
TaxonomyHost-Associated → Insecta → Digestive System → Unclassified → Unclassified → Drosophila Neotestacea Female Adult Gut → Drosophila Gut Microbial Communities From New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal proximal gut

Location Information
LocationMendon Ponds Park, Monroe County, NY, USA
CoordinatesLat. (o)43.025606Long. (o)-77.572811Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060965Metagenome / Metatranscriptome132Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0104043_1098429All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae723Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0104043_1098429Ga0104043_10984292F060965MRYSLINNVKLTLALFMTRFGANYTNYAMALDDLTVAADPLY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.