Sample 3300007058

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300007058

3300007058: Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut

Overview

Basic Information
IMG/M Taxon OID	3300007058 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114771 \| Gp0126732 \| Ga0104043
Sample Name	Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut
Sequencing Status	Permanent Draft
Sequencing Center	Cornell University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	55383107
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Drosophila Gut Microbial Communities From New York, Usa
Type	Host-Associated
Taxonomy	Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Drosophila Neotestacea Female Adult Gut → Drosophila Gut Microbial Communities From New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut

Location Information
Location	Mendon Ponds Park, Monroe County, NY, USA
Coordinates	Lat. (^o)	43.025606	Long. (^o)	-77.572811	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060965	Metagenome / Metatranscriptome	132	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0104043_1098429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	723	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0104043_1098429	Ga0104043_10984292	F060965	MRYSLINNVKLTLALFMTRFGANYTNYAMALDDLTVAADPLY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.