NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007036

3300007036: T18 (1) (Live), Syntrophic microbial communities from an anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom ? benzoate enriched in lab, transferred 6 times



Overview

Basic Information
IMG/M Taxon OID3300007036 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117429 | Gp0123698 | Ga0102617
Sample NameT18 (1) (Live), Syntrophic microbial communities from an anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom ? benzoate enriched in lab, transferred 6 times
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size57230843
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biomeriversediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054136Metagenome140Y
F064746Metagenome / Metatranscriptome128N
F102132Metagenome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0102617_104764All Organisms → cellular organisms → Bacteria1720Open in IMG/M
Ga0102617_122177All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.647Open in IMG/M
Ga0102617_129642Not Available532Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0102617_104764Ga0102617_1047642F102132METQKVVKNLESAINRICKDIKDKKGGSGADKLDSLAKLVNAYSRLIERDREKEKEYDPMEDGDPNYYKKLEANNKDRRGIIR*
Ga0102617_122177Ga0102617_1221771F064746ALDDKWDNSSREVSKYKPADLEDQFGIPDGAYDWTGLADYGAFDYRSGEPSGSMTKYGWANIFVLKPDDDLSDSSSIDILKHATYLLINPKDHRNAVIGGDLTEKEIEYNGRQAYYIEVEGELITPENYHTFINDNSQGAIAFFLDDGKVCVIDAFTTNNYGMSAWDIIDSITVTS*
Ga0102617_129642Ga0102617_1296422F054136MIENKAQLLADLAYVGSKVQAKTNVYIFAGAAFMWHGLKDATKDIDICCSYEEADRIVSELRMFGNMESVTGINDVHFLRITFKSFALQIFIKGIWMGDEYPLLEAAHSDSLSFGGITFLIPDVKTLIMI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.