| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300007027 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117890 | Gp0125713 | Ga0102608 |
| Sample Name | Combined Assembly of Gp0125713, Gp0125714, Gp0125715 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Shell Corporation |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 50380121 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Canada: Alberta | |||||||
| Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.65 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059711 | Metagenome | 133 | Y |
| F074912 | Metagenome / Metatranscriptome | 119 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0102608_102415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 2143 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0102608_102415 | Ga0102608_1024152 | F059711 | MKSRIFHTSINLLIEPGLYTKLKMIATMKKTSMSKIIRAGISLWIDQYEKANNIIQTKKEDMDHECSDSEENRK* |
| Ga0102608_124905 | Ga0102608_1249051 | F074912 | VLVPFNQMRDLHTLALAAIRSGDVLAVTKEKYVVQFIREGLQHQLPLINMQLKKRGMRAISLKSLKK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |