NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006957

3300006957: Freshwater lake microbial communities from Singapore - a non-axenic P13C2 culture



Overview

Basic Information
IMG/M Taxon OID3300006957 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117909 | Gp0125682 | Ga0102533
Sample NameFreshwater lake microbial communities from Singapore - a non-axenic P13C2 culture
Sequencing StatusPermanent Draft
Sequencing CenterThe Singapore Centre on Environmental Life Sciences Engineering
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size28770076
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Lake Microbial Communities From Singapore - A Non-Axenic P13C2 Culture
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Singapore - A Non-Axenic P13C2 Culture

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationSingapore
CoordinatesLat. (o)1.376759Long. (o)103.898487Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082218Metagenome113N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0102533_10753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales9512Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0102533_10753Ga0102533_1075310F082218MSGTLPLREAALAAIAERIITGLPDVALDRARRAPVDVEAETLPRLVLRGEEIEADDTEEPGRTHYRIGFVVSGFAAAASDLAAEQALSTLHARLVSLLAGWTPAAPGLGDVVEQGAEFRMYDTEESALPAGEFLARFSILAIGPNGGPWSA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.