Sample 3300006896

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300006896

3300006896: Final time point T34 (3) (BES) benzoate enrichments of Methanogenic microbial communities using Athabasca oil sands as inoculum

Overview

Basic Information
IMG/M Taxon OID	3300006896 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117890 \| Gp0125670 \| Ga0102513
Sample Name	Final time point T34 (3) (BES) benzoate enrichments of Methanogenic microbial communities using Athabasca oil sands as inoculum
Sequencing Status	Permanent Draft
Sequencing Center	Shell Corporation
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	65566820
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada
Type	Environmental
Taxonomy	Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → oil reservoir → sand
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	Alberta, Canada
Coordinates	Lat. (^o)	57.02	Long. (^o)	-111.65	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030405	Metagenome / Metatranscriptome	185	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0102513_103516	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	2474	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0102513_103516	Ga0102513_1035163	F030405	ACFCTRGAVQDYDGYYFILAMAKTVTPGGSPRREPGQAAPPTT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.