Basic Information | |
---|---|
IMG/M Taxon OID | 3300006896 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117890 | Gp0125670 | Ga0102513 |
Sample Name | Final time point T34 (3) (BES) benzoate enrichments of Methanogenic microbial communities using Athabasca oil sands as inoculum |
Sequencing Status | Permanent Draft |
Sequencing Center | Shell Corporation |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 65566820 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → oil reservoir → sand |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Alberta, Canada | |||||||
Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.65 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030405 | Metagenome / Metatranscriptome | 185 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0102513_103516 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 2474 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0102513_103516 | Ga0102513_1035163 | F030405 | ACFCTRGAVQDYDGYYFILAMAKTVTPGGSPRREPGQAAPPTT* |
⦗Top⦘ |