NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006884

3300006884: Final time point T34 (1) (live) benzoate enrichments of Methanogenic microbial communities using Athabasca oil sands as inoculum



Overview

Basic Information
IMG/M Taxon OID3300006884 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117890 | Gp0125668 | Ga0102510
Sample NameFinal time point T34 (1) (live) benzoate enrichments of Methanogenic microbial communities using Athabasca oil sands as inoculum
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size46032848
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae1
All Organisms → cellular organisms → Bacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMethanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → oil reservoir → sand
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationAlberta, Canada
CoordinatesLat. (o)57.02Long. (o)-111.65Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048134Metagenome / Metatranscriptome148Y
F102132Metagenome102Y
F103105Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0102510_100437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae8336Open in IMG/M
Ga0102510_109061All Organisms → cellular organisms → Bacteria1035Open in IMG/M
Ga0102510_121798All Organisms → cellular organisms → Bacteria540Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0102510_100437Ga0102510_10043712F103105VIPDPYNTWPVVMSTNKAAQLLGVDRKTLAKNKKMLERCSEIIGDKSKVIRDRLLKELKII*
Ga0102510_109061Ga0102510_1090611F102132MSTRKVIKNLEAAIDRICEDIKDKKTGSGSDKLDSLAKLVNSYGRLIERKKEKAYDKMMDGDPKQYKRMLKAGNKDMK
Ga0102510_121798Ga0102510_1217981F048134MCTEKKIQMNLAIPESYRNYLRRLAAERMMSDPSQDVTGSAIATELLLTALNEIGKFNHKEGENKNDNK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.