Basic Information | |
---|---|
IMG/M Taxon OID | 3300006798 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114675 | Gp0119863 | Ga0079298 |
Sample Name | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2015_5_14 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 14161853 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → planetary subsurface zone → oil field production water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Ohio | |||||||
Coordinates | Lat. (o) | 40.178 | Long. (o) | -81.073 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F100750 | Metagenome / Metatranscriptome | 102 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0079298_103764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 504 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0079298_103764 | Ga0079298_1037641 | F100750 | LNIRVKDILKEHRIDVFIGTLKDNIAHDVCLWEPDSLEKAFRLARKMKRKIMATRKHTSHNYKYGSVFAPSLPQTIRFTPQQLEEKREKGFCYNCDSKCTKVISVLRRNYFT* |
⦗Top⦘ |