NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006798

3300006798: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2015_5_14



Overview

Basic Information
IMG/M Taxon OID3300006798 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114675 | Gp0119863 | Ga0079298
Sample NameDeep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2015_5_14
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size14161853
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeplanetary subsurface zoneoil field production water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: Ohio
CoordinatesLat. (o)40.178Long. (o)-81.073Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F100750Metagenome / Metatranscriptome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0079298_103764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus504Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0079298_103764Ga0079298_1037641F100750LNIRVKDILKEHRIDVFIGTLKDNIAHDVCLWEPDSLEKAFRLARKMKRKIMATRKHTSHNYKYGSVFAPSLPQTIRFTPQQLEEKREKGFCYNCDSKCTKVISVLRRNYFT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.