NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006782

3300006782: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2014_10_10



Overview

Basic Information
IMG/M Taxon OID3300006782 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114675 | Gp0119849 | Ga0079284
Sample NameDeep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2014_10_10
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size19799876
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeplanetary subsurface zoneoil field production water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: Ohio
CoordinatesLat. (o)40.178Long. (o)-81.073Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016966Metagenome / Metatranscriptome243Y
F060849Metagenome132N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0079284_103788Not Available809Open in IMG/M
Ga0079284_104425Not Available706Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0079284_103788Ga0079284_1037883F016966MKNVTFTRVKNQSLPNLYSGTINGEIVGFIYKPTDTKSDRNAWRSYVGVGDKARFLYHTWDMNDAMEAVQLAVK*
Ga0079284_104425Ga0079284_1044252F060849MNNTFPTLKEIQDVRVSRAPLTVDQMVKRIGDTVRLNYKNPELYSVTVNFPEFGHNSTNGHHFSDMFNDVIRKIPNHYECYWSWMSSDLTFYIKW*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.