NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006701

3300006701: Marine microbial communities from the Deep Atlantic Ocean - MP2916 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300006701 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054934 | Ga0005519
Sample NameMarine microbial communities from the Deep Atlantic Ocean - MP2916 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size78878714
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)29.5801Long. (o)-23.4114Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007073Metagenome / Metatranscriptome358Y
F056539Metagenome / Metatranscriptome137Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0005519_1128642Not Available869Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0005519_1120755Ga0005519_11207551F056539KVQAVLLLALLGLVSCQLALVNPEGRGFSFHDARHGPCGQSPSEPGNRIAWEQNSVREIEVQILGAAGGGVIVDRYSCVRNGDDENPIEPILPIEGALKVKVPDFDDQIYRLYVRTPSFRCTGDVTMQLVYSAENGQEFFQCQDIVLTYSGASALSMSIFAVIALALMIL*
Ga0005519_1128642Ga0005519_11286421F007073KLFVVLVAFCAAALALDAVGEGFAGSPDQVINPANWHGTWTANNRYGGQMYACPKGDRLYGVYSNAGFFIGRIEGRVVEGTWYEGGRGDRNDWQGAFRIELDADNQGFDGFYHRVTQDGTELRWKEERLGAPWPSNPTQDQCLVPGDEPLLGNFYNEAGQGRESAVYSLCKDEFDQIYGSFGSPDGFLEGWSVDDSTGFHGYRYDSNGRSGAYILRAVSDTVVKGFYWRGRLARQNIETSVPETLHRTSYTSRLDDCERVGPGFLRRLRGPTAAAGTLNVSMVVVALVA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.