| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006697 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0092402 | Ga0031668 |
| Sample Name | Metatranscriptome of deep ocean microbial communities from South Indian Ocean - MP0895 (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 77101522 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 5 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | East of Durban, South Africa, South Indian Ocean | |||||||
| Coordinates | Lat. (o) | -33.56 | Long. (o) | 39.88 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006551 | Metagenome / Metatranscriptome | 370 | Y |
| F030135 | Metagenome / Metatranscriptome | 186 | Y |
| F063612 | Metatranscriptome | 129 | Y |
| F090441 | Metatranscriptome | 108 | N |
| F093997 | Metagenome / Metatranscriptome | 106 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0031668_1013861 | Not Available | 752 | Open in IMG/M |
| Ga0031668_1068015 | Not Available | 569 | Open in IMG/M |
| Ga0031668_1174319 | Not Available | 635 | Open in IMG/M |
| Ga0031668_1177795 | Not Available | 603 | Open in IMG/M |
| Ga0031668_1178250 | Not Available | 752 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0031668_1013861 | Ga0031668_10138611 | F030135 | REELATLSSFTDIGHATFVGCQFPDAILPGGEAIDLVAGPLN* |
| Ga0031668_1068015 | Ga0031668_10680152 | F093997 | QAGLDDDRSGEDKPASDKGGLKMQKKSDEDTELIEKAEHSFNTETPRPNASIENVDKSIKDSSLILKDARAEGYEGLSQVARNILNGKYYVPSDDEVRGF* |
| Ga0031668_1174319 | Ga0031668_11743191 | F006551 | GSGHYDPWAANATIDRDSGTAFDCTVESASGTIGTNGVLTDDTLRAFLRKIRIAAGKDPNVFLGSHEVYSEIQGLYMPSVRIPNPYGESLVQIDVNGIQTFKGTGVGIHVDSIYGIPFIPSKDAPSSSSDSSEVGRLFAFDTSDAEGYGYPRIGIQIAIPTEYYEATRRSPGYPFVNNAFVEKGVFRTMGETVCRHFRSQGKIRDIKL* |
| Ga0031668_1177795 | Ga0031668_11777951 | F090441 | KGEVWELATLSFPDSLALGALITRRVIVGCQFPDAASYRKNDCDMFRFHSGT* |
| Ga0031668_1178250 | Ga0031668_11782501 | F063612 | KSVAGGSPADEAASVAEESGLKIPRRGTGSKEDVYSPAL* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |