NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006668

3300006668: T14 (1) BES Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times



Overview

Basic Information
IMG/M Taxon OID3300006668 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117429 | Gp0125122 | Ga0101756
Sample NameT14 (1) BES Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size43686489
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
Not Available2
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum1
All Organisms → cellular organisms → Bacteria → Terrabacteria group1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biome → river → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020363Metagenome / Metatranscriptome224Y
F030486Metagenome / Metatranscriptome185Y
F050777Metagenome / Metatranscriptome145N
F090409Metagenome108Y
F102132Metagenome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0101756_107186All Organisms → cellular organisms → Bacteria1066Open in IMG/M
Ga0101756_110838Not Available817Open in IMG/M
Ga0101756_112897Not Available734Open in IMG/M
Ga0101756_122213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum519Open in IMG/M
Ga0101756_123485All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0101756_107186Ga0101756_1071864F030486NVRRYVALAQSRGDARFYTRGAMCDYDVITLFSRWQKP*
Ga0101756_110838Ga0101756_1108382F090409LARGRSNRGDRMKKQFAGTLLTSFGMMGSVHFNLELPGSIIGDTNQFLEGAKGKRVLVTVETEEVMA*
Ga0101756_112897Ga0101756_1128971F050777MDADIVYEKAVEILNPGRLYFAIKAMRKSPVKISFDMGDLNLTSGAASSLVSIEGKLPEEVQAMQWLVPLEDLLILQDLIPPDTYYWESRAQVLEWQCDLFVDSTIDEKSPLESLELEEEYRDQLLVSNREYRKLQMALDDCNCHIPQVLFSIYPDR
Ga0101756_122213Ga0101756_1222131F020363MRLHLTFGGMCCWRRVAVARVFALVVRCRDMMLFFYCRVGKNRDTKRESPAGAGAGRTADHLTFLFSQKVLAVRKANDNTDLL
Ga0101756_123485Ga0101756_1234851F102132MSTTKVIKNLERAINRICDDIKEKKGGSGSDKLNSLSKLVNSYSRLIERSKNNEVDPLMDGDPEYYENLQKPKDRSSVIR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.