NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006667

3300006667: T8 (1) BES Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times



Overview

Basic Information
IMG/M Taxon OID3300006667 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117429 | Gp0125117 | Ga0101751
Sample NameT8 (1) BES Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size45549417
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea2
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biomeriversediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040697Metagenome / Metatranscriptome161Y
F047387Metagenome / Metatranscriptome150Y
F050777Metagenome / Metatranscriptome145N
F054136Metagenome140Y
F093892Metagenome106Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0101751_105343All Organisms → cellular organisms → Archaea1398Open in IMG/M
Ga0101751_107788All Organisms → cellular organisms → Archaea1062Open in IMG/M
Ga0101751_109918All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.895Open in IMG/M
Ga0101751_114188Not Available694Open in IMG/M
Ga0101751_114369Not Available688Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0101751_105343Ga0101751_1053431F040697LKETVIAMKLIEKLVDDNVMDDILKEAADGYGDLIAAALVHKVSVKSLQTRVTELRDLRAAWIS*
Ga0101751_107788Ga0101751_1077881F047387ELNMAAEIANEVLTDEEYADAEYRRLLKEKDKYMDFDEFCREEGI*
Ga0101751_109918Ga0101751_1099181F054136MIENKAQLLADLAYVGSKVQAKTNVYIFAGAAFMWHGLKDATKDIDICCSYEEADRIVSELRMFGNMESVTGINDVHFLRIIFKSFSLQIFIKGIWMGDEYPLLEAAHSDSLSFGGITFLIPDVKTLIMI
Ga0101751_114188Ga0101751_1141882F093892MIFLSKYQDNQLAEPVKTKTSPFRSLDRTCNQIEEVFTREKSSER
Ga0101751_114369Ga0101751_1143691F050777MEDDIIYEKAVEILNPGRLYFALKAMRSSPVKISFDMGDLNLTSGPVSSLISIEGNLPEEVLAMQWLVPLGDLKILQDLIPPDTYYWENRALVLEWQCDLVVDSTIDEKNPLESIEQEEEYRDQLLVSNREYRKLQMALDDCNYNIPQVLFSIYPDQLNFAVNCSQHDEIVGTMIQMKGQKEA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.