NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006659

3300006659: T10 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times



Overview

Basic Information
IMG/M Taxon OID3300006659 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117429 | Gp0125104 | Ga0101733
Sample NameT10 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size50762654
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1
All Organisms → cellular organisms → Bacteria → Terrabacteria group1
Not Available1
All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biomeriversediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020363Metagenome / Metatranscriptome224Y
F054136Metagenome140Y
F080090Metagenome / Metatranscriptome115Y
F100040Metagenome103N
F102132Metagenome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0101733_110605All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales950Open in IMG/M
Ga0101733_115452All Organisms → cellular organisms → Bacteria → Terrabacteria group774Open in IMG/M
Ga0101733_119562Not Available676Open in IMG/M
Ga0101733_124510All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon593Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0101733_110605Ga0101733_1106051F020363MTLNGFFPALAVTFGGMWRWRRVAVARVFALVVRCRVMRLLLYSRVGKNRDTWRESPVGAGAGRTADHLTVLFSQKVLAVRKANDIY
Ga0101733_114253Ga0101733_1142531F100040PDLEKMISLGRKGIIDPDHMKRWGEFKKEWAEADLIIWNKLKERMATGDSGALELRPPLSPSEKEWAKKIITQAEERNLC*
Ga0101733_115452Ga0101733_1154523F102132MSTTKVIKNLERAINRICADIKEKKGGSGSDKLKSLSKLVNSYSRLIERSKNNEVDPLMDGDPEYYSSLQKQKDRSGVIR*
Ga0101733_119562Ga0101733_1195621F054136MIENKAQLLADLAYVGSKVQAKTNVYIFSGAAFLWHGLKDATKDIDICCSYEEADRIVSELRMFGNMESVTGINDVHFLRITFKSFALQIFIKGIWMGDEYPLLEAAHSDSLSFGGITFLIPDVKTLIMIRDRQIQALYNEWKKLQGEKCV*
Ga0101733_124510Ga0101733_1245102F080090MIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.