NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006657

3300006657: T14 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times



Overview

Basic Information
IMG/M Taxon OID3300006657 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117429 | Gp0125107 | Ga0101736
Sample NameT14 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size50933914
Sequencing Scaffolds5
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea1
Not Available3
All Organisms → cellular organisms → Bacteria → Terrabacteria group1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biome → river → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050777Metagenome / Metatranscriptome145N
F054136Metagenome140Y
F064732Metagenome / Metatranscriptome128Y
F101218Metagenome / Metatranscriptome102Y
F102132Metagenome102Y
F105254Metagenome / Metatranscriptome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0101736_103949All Organisms → cellular organisms → Archaea1708Open in IMG/M
Ga0101736_115671Not Available754Open in IMG/M
Ga0101736_117025All Organisms → cellular organisms → Bacteria → Terrabacteria group716Open in IMG/M
Ga0101736_124720Not Available566Open in IMG/M
Ga0101736_127582Not Available526Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0101736_103949Ga0101736_1039493F054136MIENKAQLLADLAYVGSKVQAKTNVYIFAGAAFMWHGLKDATKDIDICCSYEEADRIVSELRMFGNMESVTGINDVHFLRITFKSFALQIFIKGIWMGDEYQLLEAAHSDSLSFGGITFLIPDVKTLIMIRDRQIQALYNEWKKLQGEKCV*
Ga0101736_115671Ga0101736_1156711F050777MEDDIIYEKAVEILNPGRLYFALKAMRSSPVKISFDMGDLNLTSGPVSSLISIEGNLPEEVLAMQWLVPLGDLKILQDLIPPDTYYWENRALVLEWQCDLVVDSTIDEKNPLESIEQEEEYRDQLLVSNREYRKLQMALDDCNSHIPQVLFSIYPDRLNFAVNCSQHDEIV
Ga0101736_117025Ga0101736_1170252F102132METQKVVKNLESAINRICKDIKDKKGGSGADKLDSLAKLVNAYSRLIERDKEKEKEIDPMEDGDPTYYKRLEANNKDRRGIIR*
Ga0101736_124249Ga0101736_1242491F105254MAETATIYRLYGAQGTKNSLAGKVGRFCTQDAEPGLNNPCKVPPTGVYDSFRVTDCLGITGDFNQVREIYIHGDGNFADDWGLDSANGGGLFIGHRDSGDSGLPIDAVLHGSNQYAVATGTIGTKGDSIEDPTNGHPYYRTQSVKVLDFDDCTAESPLLIDSGPY
Ga0101736_124720Ga0101736_1247202F101218MSKKGFNPNLSRAKEILPSPPLPSLDELVAESRAVGWDDLADSMEKLRHLETPKGQRALERRERRLSRL*
Ga0101736_127582Ga0101736_1275821F064732MEAATEAALAAAPERCTMPPALSAERHVKFPSSPMDPGRCTAAIATRSTSLPDRPEDTDYFVGTNMGQG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.