| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006559 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117798 | Gp0124963 | Ga0101391 |
| Sample Name | Marine microbial communities from the Black Sea in Odessa region - Od_3 |
| Sequencing Status | Finished |
| Sequencing Center | Hellenic Centre for Marine Research (HCMR) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 15417702 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Investigation Of Black Sea Water Bacterial Metagenome |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Investigation Of Black Sea Water Bacterial Metagenome |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Odessa, Odessa region, Ukraine | |||||||
| Coordinates | Lat. (o) | 46.440968 | Long. (o) | 30.772294 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001926 | Metagenome / Metatranscriptome | 616 | Y |
| F001971 | Metagenome / Metatranscriptome | 609 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0101391_1000393 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium | 796 | Open in IMG/M |
| Ga0101391_1001896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 567 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0101391_1000393 | Ga0101391_10003931 | F001926 | VRHEDIPDINNPKIRYAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDP* |
| Ga0101391_1001896 | Ga0101391_10018962 | F001971 | MTYEEFIHKGTDFYMDMVRLVDIKLKRRMELTEKEKEIQDHILEFQKQIKINELRDRFEKCWEVDE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |