x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300006517
3300006517: Sludge microbial communities from wastewater anaerobic digester in Oakland, CA, USA ? phosphite and CO2 enriched
Overview
Basic Information
IMG/M Taxon OID 3300006517 Open in IMG/M GOLD Reference Gs0117790 | Gp0124740 | Ga0100964 Sample Name Sludge microbial communities from wastewater anaerobic digester in Oakland, CA, USA ? phosphite and CO2 enriched Sequencing Status Permanent Draft Sequencing Center QB3 Vincent J. Coates Genomics Sequencing Laboratory Published? Y Use Policy Open
Dataset Contents
Total Genome Size 50951843 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → Viruses → environmental samples → uncultured marine virus 1 Not Available 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Sludge Microbial Communities From Wastewater Anaerobic Digester In Oakland, Ca, Usa - Phosphite And Co2 Enriched Type Engineered Taxonomy Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Wastewater → Sludge Microbial Communities From Wastewater Anaerobic Digester In Oakland, Ca, Usa - Phosphite And Co2 Enriched
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
Location Information
Location Oakland, CA, USA Coordinates Lat. (o ) 37.825917 Long. (o ) -122.295833 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F011593 Metagenome / Metatranscriptome 289 Y F070092 Metagenome 123 N
Sequences
Scaffold ID Protein ID Family Sequence
Ga0100964_100100 Ga0100964_1001002 F011593 MVTDNNLTAPPWCLGCPDPIYDDRRGEWDWYCRQHSPTGIRCSNVAVLRERCYRVREYFAKKEASK* Ga0100964_120269 Ga0100964_1202691 F070092 MAINDRLKPVMELLETSKQKIDLMISHGMASDLAIERRKKELYDEVMIAKENAFKEELAELEGEIRKIEDSYREPKKDPTTKLLEFEQIKAKIRSTPSKELKELTHKFQNTGAIPGIPWERPDHVDVLVAELRNRGLDEEADLTWDYAYNKLKVDRPWENNPLYKQLKSQHNKVSVLA
