NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006450

3300006450: Minimetagenome of a non-axenic cylindrospermopsis culture from a freshwater lake in Singapore



Overview

Basic Information
IMG/M Taxon OID3300006450 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117458 | Gp0123955 | Ga0100045
Sample NameMinimetagenome of a non-axenic cylindrospermopsis culture from a freshwater lake in Singapore
Sequencing StatusPermanent Draft
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size86447036
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMinimetagenome Of A Non-Axenic Cylindrospermopsis Culture From A Freshwater Lake In Singapore
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Minimetagenome Of A Non-Axenic Cylindrospermopsis Culture From A Freshwater Lake In Singapore

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationSingapore
CoordinatesLat. (o)1.3991438Long. (o)103.77518Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051937Metagenome143Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0100045_100558All Organisms → cellular organisms → Bacteria8089Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0100045_100558Ga0100045_1005585F051937MLTAEQVGGIVRAIMAALGGYAVGQGLTDAETMATIGGAVTTLAAAIWSIWAKRKAATE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.