| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006450 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117458 | Gp0123955 | Ga0100045 |
| Sample Name | Minimetagenome of a non-axenic cylindrospermopsis culture from a freshwater lake in Singapore |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 86447036 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Minimetagenome Of A Non-Axenic Cylindrospermopsis Culture From A Freshwater Lake In Singapore |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Minimetagenome Of A Non-Axenic Cylindrospermopsis Culture From A Freshwater Lake In Singapore |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Singapore | |||||||
| Coordinates | Lat. (o) | 1.3991438 | Long. (o) | 103.77518 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051937 | Metagenome | 143 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0100045_100558 | All Organisms → cellular organisms → Bacteria | 8089 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0100045_100558 | Ga0100045_1005585 | F051937 | MLTAEQVGGIVRAIMAALGGYAVGQGLTDAETMATIGGAVTTLAAAIWSIWAKRKAATE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |