NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006431

3300006431: T18 (1) (BES), Syntrophic microbial communities from an anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom ? benzoate enriched in lab, transferred 6 times



Overview

Basic Information
IMG/M Taxon OID3300006431 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117429 | Gp0123708 | Ga0099701
Sample NameT18 (1) (BES), Syntrophic microbial communities from an anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom ? benzoate enriched in lab, transferred 6 times
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size29674326
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → river → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068879Metagenome / Metatranscriptome124N
F093892Metagenome106Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0099701_101941All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae1591Open in IMG/M
Ga0099701_102844All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae1266Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0099701_101941Ga0099701_1019413F093892MIFLSKYQDNQLAEPVKTKTSPFRSLDRTCNQIEEVFTREKSSERKTYI*
Ga0099701_102844Ga0099701_1028441F068879APASNRSVYAIAFPWRDYFVTEEERFVAGATAWPRSRGALPHGVTVFANARIN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.