NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006283

3300006283: Prairie soil microbial communities from Kansas, USA, after rainfall - K15



Overview

Basic Information
IMG/M Taxon OID3300006283 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114560 | Gp0113286 | Ga0099601
Sample NamePrairie soil microbial communities from Kansas, USA, after rainfall - K15
Sequencing StatusPermanent Draft
Sequencing CenterOregon State University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size7572480
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePrairie Soil Microbial Communities From Kansas, Usa, After Rainfall
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Prairie Soil → Prairie Soil Microbial Communities From Kansas, Usa, After Rainfall

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeprairiebulk soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationKonza Prairie, Kansas, USA
CoordinatesLat. (o)39.1038Long. (o)-96.6133Alt. (m)N/ADepth (m).2
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027947Metagenome / Metatranscriptome193Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0099601_10077637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales671Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0099601_10077637Ga0099601_100776372F027947MLKFDASIFGGELPVGLGVVGIAVMLPGGDFVDEDLFVGNAAVEALGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.