x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300006236
3300006236: Marine sediment microbial communities, 0.6 km from oil contamination, elevated hydrocarbon, Gulf of Mexico? BC350
Overview
| Basic Information |
| IMG/M Taxon OID | 3300006236 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0116840 | Gp0121738 | Ga0082396 |
| Sample Name | Marine sediment microbial communities, 0.6 km from oil contamination, elevated hydrocarbon, Gulf of Mexico? BC350 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Yale Center for Genome Analysis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 24269647 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| Not Available | 3 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico |
| Location Information |
| Location | Gulf of Mexico |
| Coordinates | Lat. (o) | 28.3 | Long. (o) | -88.2 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F030135 | Metagenome / Metatranscriptome | 186 | Y |
| F056191 | Metagenome / Metatranscriptome | 138 | Y |
| F082867 | Metagenome / Metatranscriptome | 113 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0082396_116224 | Ga0082396_1162242 | F056191 | MICDARDRHALTAEMLEIFLSGGSMHASVKLEGIDGRAP |
| Ga0082396_121406 | Ga0082396_1214061 | F082867 | MTGGRKKGSRSRRVHHINDINHNDTNITVQYIVVKPLTFSSNTLVLSVNPSLTDLSTTLATIYRQYRVTELSFTFQCSDAAGAYALAMQYVPQIGGTPSTLPTTLAEFEGPAVGYCETGRGREYTYRVPSHVLNAMGLNYYATRTGVTPIQDPDILTQGLMIFLTSTPATPIVAYMHVKFEFQTLEDPSFLAKLMHDDKEADTLVVPRAKADSLKSMTWNQL* |
| Ga0082396_131111 | Ga0082396_1311111 | F030135 | ATLSSFADIWHSTFVGCQLPDAILPGREAIDLVAGPLN* |
