NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006229

3300006229: Marine sediment microbial communities, 0.9 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC143



Overview

Basic Information
IMG/M Taxon OID3300006229 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0116840 | Gp0121733 | Ga0082389
Sample NameMarine sediment microbial communities, 0.9 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC143
Sequencing StatusPermanent Draft
Sequencing CenterYale Center for Genome Analysis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size36826477
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota3
Not Available2
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine benthic biome → marine benthic feature → marine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationGulf of Mexico
CoordinatesLat. (o)28.3Long. (o)-88.2Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006424Metagenome / Metatranscriptome373Y
F018020Metagenome / Metatranscriptome237Y
F027881Metagenome / Metatranscriptome193Y
F070259Metagenome / Metatranscriptome123Y
F082867Metagenome / Metatranscriptome113Y
F084398Metagenome / Metatranscriptome112N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0082389_116841All Organisms → cellular organisms → Eukaryota1647Open in IMG/M
Ga0082389_118221All Organisms → cellular organisms → Eukaryota926Open in IMG/M
Ga0082389_121780Not Available695Open in IMG/M
Ga0082389_123812All Organisms → cellular organisms → Eukaryota685Open in IMG/M
Ga0082389_128340Not Available635Open in IMG/M
Ga0082389_145836All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta630Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0082389_116841Ga0082389_1168411F070259MKSESLVIVNQNVTVNDTSNFAHTAHHARKIVLAGNLVFFFL
Ga0082389_118221Ga0082389_1182211F006424VIRTGRVNTVLIGNDFPELGTHLVTALTCLNVDDLSH
Ga0082389_121780Ga0082389_1217801F082867MTGGRKKGSRSRRVHHINDINHNDTNITVQYRVVKPLTFSSNTLVLSVNPSLTDLSTTLATIYRQYRVTELSFTFQCSDAAGAYALAMQYVPQIGGTPSTLPTTLAEFEGPAVGYCETGRGREYTYRVPSHVLNAMGLNYYATRTGVTPIQDPDILTQGLMIFLTSTPATPIVAYMHVKFEFQTLEDPSFLAKLMHDDKEADTLVVPRAKADSLKSMTW
Ga0082389_123812Ga0082389_1238121F018020VSDTLGDGTTENVSIILSGYSSLTFEINNVPIPDPVPPPKEWVI*
Ga0082389_128340Ga0082389_1283401F027881VMSLTVARSERVRGVLTHASRMKFCGIKLNGVRVSNTLKFFLKLT*
Ga0082389_145836Ga0082389_1458361F084398MARLELTLNFPKSFQVKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.