Sample 3300006067

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300006067

3300006067: Hotspring Microbial Communities from Mammoth Norris Corridor Bijah Springs, Spring 3, Yellowstone National Park, Wyoming, USA - Mini-Metagenomics

Overview

Basic Information
IMG/M Taxon OID	3300006067 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0116709 \| Gp0121446 \| Ga0081426
Sample Name	Hotspring Microbial Communities from Mammoth Norris Corridor Bijah Springs, Spring 3, Yellowstone National Park, Wyoming, USA - Mini-Metagenomics
Sequencing Status	Permanent Draft
Sequencing Center	Stanford University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	5794453
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Mini-Metagenome - Microbial Communities From The Yellowstone National Park
Type	Environmental
Taxonomy	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hotspring → Mini-Metagenome - Microbial Communities From The Yellowstone National Park

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → hot spring → spring water
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.761133	Long. (^o)	-110.7309	Alt. (m)	N/A	Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040649	Metagenome / Metatranscriptome	161	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0081426_12373	All Organisms → cellular organisms → Bacteria	3529	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0081426_12373	Ga0081426_123733	F040649	MRKLNIDNPAKLFAQLSAITNACDPNEYAPLEYRIQGEEIELPDGSPATGDWLLAIKAVELADDLVQHAEGNGAMRRSFRLVYLAPLETYFWGGYYWRDPVGFTILVRWHRVPKDYNPQLDQIRQRNTDRRRSDA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.