NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006017

3300006017: Rhizosphere microbial communities from Harvard Forest, USA - 6Rhizosphere_unsorted metaG



Overview

Basic Information
IMG/M Taxon OID3300006017 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053064 | Gp0104120 | Ga0058708
Sample NameRhizosphere microbial communities from Harvard Forest, USA - 6Rhizosphere_unsorted metaG
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size28678267
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameRhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Rhizosphere → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biomerhizospheresoil
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationHarvard Forest, Massachusetts, USA
CoordinatesLat. (o)42.5502Long. (o)-72.1737Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005160Metagenome / Metatranscriptome410Y
F046057Metagenome / Metatranscriptome152Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0058708_1000106All Organisms → cellular organisms → Bacteria678Open in IMG/M
Ga0058708_1000211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium596Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0058708_1000106Ga0058708_10001061F005160VPPASAILRLLVFAVPSARAAAGVQPLLGAATGVVQLRWALGLTAPAVVVAGLVFGAGRLFDRGDALQPPWYSAWVLFPGAFLLAGAAAMCIFGALTELSLIPPAMWTFLIAGSVLWAGAIVVVRSASR*
Ga0058708_1000211Ga0058708_10002111F046057SQSFGPSAIVPGSAYLLLRLSALECLTSLADGVAYYALC*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.