NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005997

3300005997: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_750_biof (version 2)



Overview

Basic Information
IMG/M Taxon OID3300005997 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118793 | Gp0095085 | Ga0066255
Sample NameWastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_750_biof (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size379281268
Sequencing Scaffolds7
Novel Protein Genes8
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta ricciae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameWastewater Bioreactor Microbial Communities From Cape Town, South Africa
TypeEngineered
TaxonomyEngineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationSouth Africa: Cape Town
CoordinatesLat. (o)-33.927Long. (o)18.452665Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017165Metagenome242Y
F019507Metagenome / Metatranscriptome229Y
F049152Metagenome / Metatranscriptome147Y
F055860Metagenome / Metatranscriptome138Y
F081545Metagenome114Y
F094111Metagenome106Y
F095751Metagenome105Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066255_1061559Not Available1038Open in IMG/M
Ga0066255_1066672All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea976Open in IMG/M
Ga0066255_1090122All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea734Open in IMG/M
Ga0066255_1116617All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea584Open in IMG/M
Ga0066255_1125175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae557Open in IMG/M
Ga0066255_1139349All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Adinetida → Adinetidae → Adineta → Adineta ricciae519Open in IMG/M
Ga0066255_1146802Not Available501Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066255_1061559Ga0066255_10615591F049152MTQTEPVLRPHRPDSLLEKAAEQLAEVFGVHRQIDKLLYHSAKEVGGVEFASIFEPVPVERLTARPRPDAINHDQAFLRSNPLSSDDTERALGLLEILHGQHAPANVEVFARFAEREKFFERLADGRSFIFVGSHLEFQDVGFNLGYLTRAAHLHGFDRLDTRTTLMIGRLLGYLEVMELNVI
Ga0066255_1066672Ga0066255_10666722F081545MDHQQLRSIIIKLESRLSDDDRERLHFYLGNDIPRKIREDASLRDTLCLMDSLFDRDKINEQDFTFLIRAFEQI
Ga0066255_1086064Ga0066255_10860642F095751EMSQAYTLKQYFDLFDNDVQRVNISTVYLNSEEEGVFDEFNDFNKEKQGYYKLIRINVTKDVVWGKITGMSREQREKITIEFLTDLYIEAHADLHAGTLTSNWCRLVDEFRLVLGKKIPYYTPEKRFIMDG*
Ga0066255_1090122Ga0066255_10901222F081545MIMDHQQLRSIIIKLETRLSDDDRERLHFYLGNDVPRKIRDDASLRGTLRLMDSLFDRDKINEQDFTFLIRAFECT
Ga0066255_1116617Ga0066255_11166171F055860VQPLDRSHVLASISIIDHDVYINYHKGVHLDQYRVSTTSQWTLEKRFSKSDCCEAKDIGIRDVRCDAQSICLSIMQQGDLKWRLDIMSRDMKRIRRGTPMDAGENQHKFFSMLISLHDQRWLFVNWYTNKLWLVDQEGKPGLIKDSKIKNIRNICISPNGTYMAVRTEKPNTLKLYKLV*
Ga0066255_1125175Ga0066255_11251751F019507MDIRQLVDIAIDEDPRAPCLWVPSELFPELCAAIGQQPNLVGAVIYRNKTIRDGGPYCDITTRAP*
Ga0066255_1139349Ga0066255_11393491F094111EMFLRIWIGLFIQQQYFTLATFSFNQPRFRINATWNSIATTFAKQSFVGQYPIGIFVNSNNSIYIPNRRTGQIHIWLNENHLNSTKTIEGNLLELLSLFVTTNGDIYVDNGYKNGRVDKWIVENERWISVMNITSTCFGLFVDIHESLYCSMQDNNRVQKMVKRYNNNRCWN
Ga0066255_1146802Ga0066255_11468021F017165RVHVIGANQWLADTFTWRPDRHRYAPSWMKQAISTMTMIRSLVDESALSMIPNEILFEIFSFL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.