NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005962

3300005962: Hot spring cone microbial streamer communities from Mammoth Hot Spring (Liberty Cap Streamers), Yellowstone National Park, USA - T=72



Overview

Basic Information
IMG/M Taxon OID3300005962 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0067861 | Gp0054656 | Ga0081479
Sample NameHot spring cone microbial streamer communities from Mammoth Hot Spring (Liberty Cap Streamers), Yellowstone National Park, USA - T=72
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size28591104
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSaline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Cone → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehot springspring water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationMammoth Hot Spring (Liberty Cap Streamers), Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.972867Long. (o)-110.704443Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073601Metagenome / Metatranscriptome120Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0081479_110795Not Available2168Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0081479_110795Ga0081479_1107955F073601MALPAKRREGQRMFWVLHFAWCCAIKIMECGSIIRTLPVEKRALAGMGVLLQQE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.