| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005808 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110099 | Gp0072822 | Ga0079972 |
| Sample Name | Basalt sediment microbial communities from the East Pacific Rise Rocks |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 5626904 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Basalt Sediment Microbial Communities From The East Pacific Rise |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Benthic → Basalt Sediment → Basalt Sediment Microbial Communities From The East Pacific Rise |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | ocean biome → marine benthic feature → basalt |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | East Pacific Rise | |||||||
| Coordinates | Lat. (o) | 9.725 | Long. (o) | -104.16 | Alt. (m) | N/A | Depth (m) | 2674 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092086 | Metagenome | 107 | Y |
| F093890 | Metagenome / Metatranscriptome | 106 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0079972_13325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 623 | Open in IMG/M |
| Ga0079972_13527 | Not Available | 622 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0079972_13325 | Ga0079972_133251 | F092086 | IALSACSGADDVLENVGDVSVPDQLTGCVERNKDGETCDKAACVADDESDCKSWVKACKKFDHVADVRNGIDTCERKEVSPDS* |
| Ga0079972_13527 | Ga0079972_135271 | F093890 | VRPRLRFFLFLLSWILSISLFSTVLWANPTFLNRQAYPLPLGLHEIGQFHNNDLKTFEVWTQWSNPSNEKXVVKVTXSFYDKDSADSQLGEDGKDDLLMTVTESVTIPEQTSNWGKYFQLTAIGHKLNQGFDHPGEGAGLELYLDAQVISVKHLP |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |