| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005796 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0112339 | Gp0119885 | Ga0079492 |
| Sample Name | Subglacial sediment microbial community from Lake Whillans, Antarctica - at 14-16 cm depth |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Marine Biological Laboratory |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 29255309 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → subglacial lake → lake sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | West Antarctica | |||||||
| Coordinates | Lat. (o) | -84.24 | Long. (o) | -153.694 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027521 | Metagenome / Metatranscriptome | 194 | Y |
| F041287 | Metagenome / Metatranscriptome | 160 | Y |
| F045206 | Metagenome / Metatranscriptome | 153 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0079492_100331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 6078 | Open in IMG/M |
| Ga0079492_111622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 847 | Open in IMG/M |
| Ga0079492_116716 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0079492_100331 | Ga0079492_1003317 | F041287 | MEVCFKCRNQADFICPDCGTKVCIAHAELRYSGPHRGLKSRYMCPICWKMKRVVLNESMLNAREYKPKLYVFSSRKIGI* |
| Ga0079492_111622 | Ga0079492_1116221 | F045206 | PGDELDEVRIVEVIVRGPGMSKAARSPLGVAMPKSPTKPQTPNKG* |
| Ga0079492_116716 | Ga0079492_1167162 | F027521 | MNTKLLDIMVWLLFLGGVFGFVMGMLKFFGDGTPAEIGVMGIGGGFYLLSSAIIIYIRNQVKTD* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |