NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005795

3300005795: Subglacial sediment microbial community from Lake Whillans, Antarctica - at 4-6 cm depth



Overview

Basic Information
IMG/M Taxon OID3300005795 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0112339 | Gp0119884 | Ga0079491
Sample NameSubglacial sediment microbial community from Lake Whillans, Antarctica - at 4-6 cm depth
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size45162646
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSubglacial Freshwater Microbial Communities From Lake Whillans, Antarctica
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomesubglacial lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationWest Antarctica
CoordinatesLat. (o)-84.24Long. (o)-153.694Alt. (m)N/ADepth (m).04 to .06
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087395Metagenome110Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0079491_102092All Organisms → cellular organisms → Bacteria → Proteobacteria4949Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0079491_102092Ga0079491_1020923F087395VNPELHLPIFLSAFVALQGLFTLWSYRTSGSAPTALLVGLLPLVGLPYQLWQLRARLFDNHIAGMITYLALITACFGFYFLMPADETPWMLIHTMAIFAFLGTANVIGTSLKE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.