Sample 3300005788

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005788

3300005788: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_Marker33_DNA

Overview

Basic Information
IMG/M Taxon OID	3300005788 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0111355 \| Gp0107629 \| Ga0079398
Sample Name	Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_Marker33_DNA
Sequencing Status	Permanent Draft
Sequencing Center
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	17685726
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	Axial seamount, northeast pacific ocean
Coordinates	Lat. (^o)	45.9332	Long. (^o)	-129.982268	Alt. (m)	N/A	Depth (m)	1516
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097524	Metagenome / Metatranscriptome	104	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0079398_11309	All Organisms → cellular organisms → Bacteria → Proteobacteria	2588	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0079398_11309	Ga0079398_113093	F097524	MFESDNLYLPVAERRPFVNVQLKPAETISAAETHLGPQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.