NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005734

3300005734: Seawater microbial communities from Vineyard Sound, MA, USA - crude oil ammended T7



Overview

Basic Information
IMG/M Taxon OID3300005734 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114816 | Gp0117151 | Ga0076922
Sample NameSeawater microbial communities from Vineyard Sound, MA, USA - crude oil ammended T7
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Wisconsin, Madison
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size46817608
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Degradation Of Oil
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial Degradation Of Oil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemesocosmsea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA
CoordinatesLat. (o)41.4417Long. (o)-70.7744Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073435Metagenome / Metatranscriptome120N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0076922_110128Not Available1318Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0076922_110128Ga0076922_1101285F073435MEEKNEQLRLTNSRLKALRKSTGQSIIDFFQMNDQKSEAGSRIDDYWYSGETFEMMSDDEFQIEQILMEAGAYGLRSEVDHYAKRLLEKNPLSSRVDAYVKAYHELIKD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.