NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005670

3300005670: Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90104 Phage Sequencing



Overview

Basic Information
IMG/M Taxon OID3300005670 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0111422 | Gp0115854 | Ga0074419
Sample NameEnhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90104 Phage Sequencing
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Queensland
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size28157898
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2
Not Available3
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationSt. Lucia, Queensland Australia
CoordinatesLat. (o)-27.49999Long. (o)153.012098Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002371Metagenome / Metatranscriptome566Y
F025941Metagenome / Metatranscriptome199Y
F078533Metagenome / Metatranscriptome116Y
F082719Metagenome / Metatranscriptome113Y
F091594Metagenome / Metatranscriptome107Y
F093898Metagenome / Metatranscriptome106Y
F100051Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0074419_101009All Organisms → cellular organisms → Bacteria1999Open in IMG/M
Ga0074419_101930All Organisms → cellular organisms → Bacteria3990Open in IMG/M
Ga0074419_102029Not Available530Open in IMG/M
Ga0074419_102068Not Available2963Open in IMG/M
Ga0074419_102474All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium3526Open in IMG/M
Ga0074419_102959All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3192Open in IMG/M
Ga0074419_105887All Organisms → cellular organisms → Bacteria → Proteobacteria1574Open in IMG/M
Ga0074419_115626All Organisms → cellular organisms → Bacteria → Proteobacteria669Open in IMG/M
Ga0074419_123447Not Available623Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0074419_101009Ga0074419_1010095F100051GHRYVVERVLNHGARKVGCTRCGKHWAMHDGTRSFVPWDGEFEALYAPGGILAEASEDGTPNAKVKGAE*
Ga0074419_101930Ga0074419_1019306F002371MKKKKETRGGTRKNAGAKPKYNEETKTVAFRCPLSKVDELKLIVKSKLSEWSLK*
Ga0074419_102029Ga0074419_1020292F002371RGGTRKKAGAKPKYNEQTKTVAFRCPMSKVDELKLIVKSKLSEWSLK*
Ga0074419_102068Ga0074419_1020685F002371RGGTRKNAGAKPKYNEQTKTVAFRCPMSKVDELKLIVKSKLSEWSLK*
Ga0074419_102474Ga0074419_1024748F025941MALPDKVQITQGTAIIWGEAGASGVTHTLSLDALANGAARMGASADLGANYDDEYLVYLIAETGTAPTAGTTIDLYLVCSYDGATWPAKVTGSDAAYTLGTSNANLRQAGSPVSILVATNDTNTVLIQAPVIWRPRGRYVVPIVFNQLGQAIRDETTATNNDSRVILIPRRAVVND*
Ga0074419_102959Ga0074419_1029592F091594MNDNGITTYCLGSGELKCDGCGQEKNWQALNQMPDALRKALQAQARRIDDTECILSGRPWYVAA*
Ga0074419_105887Ga0074419_1058871F093898MRFLIARAVNPQLTLLDGLRDWNNIAAALREPPRKRRQYQGDNLGEFLS*
Ga0074419_115626Ga0074419_1156263F078533MTPAEFKRARETLCLSQNDLAEVWGMGDNGGRTIRRWECGERPLNPIAAYCLQLM
Ga0074419_123447Ga0074419_1234472F082719MGTRQQDYITAIRAANRKIWDGLNELTAAQREWNALDYGTTLPAGEGANEGITRSMVGAVAFDTANALVTTLNAGHATNMAKLL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.