Basic Information | |
---|---|
IMG/M Taxon OID | 3300005630 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114432 | Gp0111842 | Ga0068834 |
Sample Name | Enriched soil aggregate microbial communities from Iowa State university to study microbial drivers of carbon cycling - Hofmockel_1000072-3 ISU MetaT (Metagenome Metatranscriptome) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 29144674 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → research facility → soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Iowa | |||||||
Coordinates | Lat. (o) | 42.0266187 | Long. (o) | -93.6486594 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F060965 | Metagenome / Metatranscriptome | 132 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0068834_100137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 747 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0068834_100137 | Ga0068834_1001371 | F060965 | GVLMVGDFTPAIRAIRYSSINNVLTLTLLMARLGADDTNHALALDDLAVAANPLD* |
⦗Top⦘ |