Basic Information | |
---|---|
IMG/M Taxon OID | 3300005625 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045009 | Gp0053398 | Ga0078785 |
Sample Name | Activated sludge viral communities from EBPR reactors in Madison, Wisconsin, USA |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 5803445 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus subtilis | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Activated Sludge Microbial Communities From Ebpr Reactors In The Us And Australia |
Type | Engineered |
Taxonomy | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Microbial Communities From Ebpr Reactors In The Us And Australia |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Madison, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 43.078418 | Long. (o) | -89.386482 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051551 | Metagenome | 144 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0078785_11057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus subtilis | 919 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0078785_11057 | Ga0078785_110572 | F051551 | MSKSELLGAIPASNAFIANAIQSSKETLRRNNGDEGDSSKALLKFPCDNDPDNDPAMFSSYDKYSHAQIMDILSGDEWSSSTE* |
⦗Top⦘ |