| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005472 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063443 | Gp0053972 | Ga0074280 |
| Sample Name | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L1 Cattail |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 2364101 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 1 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Wetland Microbial Communities From Twitchell Island In The Sacramento Delta |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → saline wetland → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Twitchell Island in the Sacramento/San Joaquin Delta, CA | |||||||
| Coordinates | Lat. (o) | 38.106796 | Long. (o) | -121.646457 | Alt. (m) | N/A | Depth (m) | 0 to .12 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F083634 | Metagenome | 112 | Y |
| F089576 | Metagenome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0074280_122 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 26757 | Open in IMG/M |
| Ga0074280_136 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica | 14803 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0074280_122 | Ga0074280_12221 | F083634 | MYNMLKMADQTISLDRIRINGRICRLARKLIVTVEHEDDRLTLFNEEFGLVVSAETLEEGIAGLSGELAALWEVYVDEDPANLTADALRLRSNLTSLVPAGVSL* |
| Ga0074280_136 | Ga0074280_13613 | F089576 | MFGLPDVTIIVFAGVTLVAIVALLYWGLTFGGHD* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |