Sample 3300005462

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005462

3300005462: Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_1000m

Overview

Basic Information
IMG/M Taxon OID	3300005462 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114420 \| Gp0111532 \| Ga0068505
Sample Name	Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_1000m
Sequencing Status	Permanent Draft
Sequencing Center	University of Hawaii
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	979766
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine aphotic zone → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Pacific Ocean
Coordinates	Lat. (^o)	22.75	Long. (^o)	-158.0	Alt. (m)	N/A	Depth (m)	1000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038276	Metagenome	166	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0068505_10374	Not Available	668	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0068505_10374	Ga0068505_103742	F038276	MNLDFLLRLTNYVNIDKQIYLAVIKQFLTVLVIINHACVLLHGNHNYKDVFYDRLGNRYIRNACDFHNLHISYNNLGLVLEKFLLYIKIINNKV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.