| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005380 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047147 | Gp0052346 | Ga0074272 |
| Sample Name | Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 16-5 In Plume |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 73128958 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine black smoker biome → black smoker → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 28.716667 | Long. (o) | -88.466667 | Alt. (m) | N/A | Depth (m) | 1125 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| F077781 | Metagenome / Metatranscriptome | 117 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0074272_115297 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes | 1167 | Open in IMG/M |
| Ga0074272_129010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1558 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0074272_115297 | Ga0074272_1152971 | F077781 | PIAAPARPAPAHLKAPAAVTGGWGSPRQNDFFILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRTADSLYLGFPRPHPGTPGLGRFWPFLALQSLSETPSHARMPRVTVARTSPETLEISPLRAAT* |
| Ga0074272_129010 | Ga0074272_1290101 | F077438 | VTSLWCVYSTHRVEPSFRQSRFETPYLCSFQLEISIALRPNVEKETSSYKN* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |