Basic Information | |
---|---|
IMG/M Taxon OID | 3300005380 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047147 | Gp0052346 | Ga0074272 |
Sample Name | Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 16-5 In Plume |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 73128958 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine black smoker biome → black smoker → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Gulf of Mexico | |||||||
Coordinates | Lat. (o) | 28.716667 | Long. (o) | -88.466667 | Alt. (m) | N/A | Depth (m) | 1125 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F077438 | Metagenome / Metatranscriptome | 117 | Y |
F077781 | Metagenome / Metatranscriptome | 117 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0074272_115297 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes | 1167 | Open in IMG/M |
Ga0074272_129010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1558 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0074272_115297 | Ga0074272_1152971 | F077781 | PIAAPARPAPAHLKAPAAVTGGWGSPRQNDFFILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRTADSLYLGFPRPHPGTPGLGRFWPFLALQSLSETPSHARMPRVTVARTSPETLEISPLRAAT* |
Ga0074272_129010 | Ga0074272_1290101 | F077438 | VTSLWCVYSTHRVEPSFRQSRFETPYLCSFQLEISIALRPNVEKETSSYKN* |
⦗Top⦘ |