NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005371

3300005371: Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Summer Sample 10335



Overview

Basic Information
IMG/M Taxon OID3300005371 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0056601 | Gp0051591 | Ga0074245
Sample NameMarine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Summer Sample 10335
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1866435
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine neritic zonesea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationLate winter and summer Antarctic waters
CoordinatesLat. (o)-64.067Long. (o)-64.767Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033598Metagenome / Metatranscriptome177N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0074245_190All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria28885Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0074245_190Ga0074245_19018F033598LAPLDIASRLRAPLPAKGSIIVLSAISNCSQLKRVSLILPGEGRSPSASGKLNFLPLRFPAIILKVLSLIRLK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.