Sample 3300005371

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005371

3300005371: Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Summer Sample 10335

Overview

Basic Information
IMG/M Taxon OID	3300005371 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0056601 \| Gp0051591 \| Ga0074245
Sample Name	Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Summer Sample 10335
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	1866435
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine neritic zone → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Late winter and summer Antarctic waters
Coordinates	Lat. (^o)	-64.067	Long. (^o)	-64.767	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033598	Metagenome / Metatranscriptome	177	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0074245_190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	28885	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0074245_190	Ga0074245_19018	F033598	LAPLDIASRLRAPLPAKGSIIVLSAISNCSQLKRVSLILPGEGRSPSASGKLNFLPLRFPAIILKVLSLIRLK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.