NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005351

3300005351: Bioreactor Anammox bacterial community from Nijmegen, The Netherlands - Scalindua species enirchment



Overview

Basic Information
IMG/M Taxon OID3300005351 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0045254 | Gp0051386 | Ga0074239
Sample NameBioreactor Anammox bacterial community from Nijmegen, The Netherlands - Scalindua species enirchment
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size20860096
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBioreactor Anammox Bacterial Community From Nijmegen, The Netherlands
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Nitrogen Removal → Anammox → Bioreactor → Bioreactor Anammox Bacterial Community From Nijmegen, The Netherlands

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationNijmegen, The Netherlands
CoordinatesLat. (o)51.842Long. (o)5.858Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061392Metagenome / Metatranscriptome132N
F078263Metagenome / Metatranscriptome116N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0074239_102774All Organisms → cellular organisms → Bacteria11689Open in IMG/M
Ga0074239_106414All Organisms → cellular organisms → Bacteria11117Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0074239_102774Ga0074239_1027745F061392VIVKRLYIICTIFIVGLFMPLQTFASGLDEPDPAFKLAAALSPIDGGELYVGNVDRDKKTFRLHLRHIGKNSKWVYYYASASAFVNEDGDVEPDNAVASLVYPQYTASVIGNTFRKARVRILFSPRGDGKGFFKEAGHVIFQECATKTFEAKNWKCTGWEYLGTLPGFE*
Ga0074239_106414Ga0074239_1064146F078263MELLHDSEELVGSLDCQLKRLEEKIDTSQSVELMKDLHRMDDEIRHFKDVEITTNSVVSSVNKQGETIKKIEEGTRNKFTEMTSQMKSTEAMVADKHKNLISKINGISSRVDSLEEKIDLAVRELKSEARKTSVLRKLLWLD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.