Sample 3300005262

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005262

3300005262: Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2)

Overview

Basic Information
IMG/M Taxon OID	3300005262 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0053073 \| Gp0061148 \| Ga0065165
Sample Name	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	471862115
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations
Type	Host-Associated
Taxonomy	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere

Location Information
Location	University of North Carolina, USA
Coordinates	Lat. (^o)	35.9082	Long. (^o)	-79.0499	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019507	Metagenome / Metatranscriptome	229	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0065165_1082117	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	835	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0065165_1082117	Ga0065165_10821171	F019507	MDARQLVDIACDEDPRAPCLWLPSDLFPEFCEAIRQKPNLIGVVIYRNKTVFDGGPYCDVTTRRP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.