Basic Information | |
---|---|
IMG/M Taxon OID | 3300005262 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053073 | Gp0061148 | Ga0065165 |
Sample Name | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 471862115 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
Type | Host-Associated |
Taxonomy | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | University of North Carolina, USA | |||||||
Coordinates | Lat. (o) | 35.9082 | Long. (o) | -79.0499 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019507 | Metagenome / Metatranscriptome | 229 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0065165_1082117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0065165_1082117 | Ga0065165_10821171 | F019507 | MDARQLVDIACDEDPRAPCLWLPSDLFPEFCEAIRQKPNLIGVVIYRNKTVFDGGPYCDVTTRRP* |
⦗Top⦘ |