x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300005212
3300005212: Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 Dark/N- metaT (Metagenome Metatranscriptome)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300005212 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0110132 | Gp0095967 | Ga0068987 |
| Sample Name | Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 Dark/N- metaT (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 35000295 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| Not Available | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Cyanobacterial Communities From The Joint Genome Institute, California, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa |
| Location Information |
| Location | USA: California |
| Coordinates | Lat. (o) | 37.9313884 | Long. (o) | -122.0239394 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F039839 | Metagenome / Metatranscriptome | 163 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0068987_148890 | Ga0068987_1488901 | F039839 | MRQTALPTRIRRMIALTRGENLARRIIPVSSRPALRRETRFGLPLTPESGGPSRHR |
