NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005212

3300005212: Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 Dark/N- metaT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300005212 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110132 | Gp0095967 | Ga0068987
Sample NameCyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 Dark/N- metaT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size35000295
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCyanobacterial Communities From The Joint Genome Institute, California, Usa
TypeHost-Associated
TaxonomyHost-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehot springmicrobial mat material
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUSA: California
CoordinatesLat. (o)37.9313884Long. (o)-122.0239394Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039839Metagenome / Metatranscriptome163Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0068987_148890Not Available508Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0068987_148890Ga0068987_1488901F039839MRQTALPTRIRRMIALTRGENLARRIIPVSSRPALRRETRFGLPLTPESGGPSRHR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.