Sample 3300005140

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005140

3300005140: Hypersaline microbial mat communities from Hot Lake, Washington, USA - Hot Lake Consortium UCC-RE (Hybrid Assembly)

Overview

Basic Information
IMG/M Taxon OID	3300005140 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0067861 \| Gp0091517 \| Ga0008835
Sample Name	Hypersaline microbial mat communities from Hot Lake, Washington, USA - Hot Lake Consortium UCC-RE (Hybrid Assembly)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	114887060
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
Type	Environmental
Taxonomy	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → hypersaline lake → microbial mat material
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Hot Lake, Washington, USA
Coordinates	Lat. (^o)	48.972613	Long. (^o)	-119.477608	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078533	Metagenome / Metatranscriptome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0008835_102295	All Organisms → cellular organisms → Bacteria	7452	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0008835_102295	Ga0008835_10229516	F078533	VTPSEFRAARNTLCLSQRDLAEVWGMGQNGERTIRRWEQGDVPVNPIAAYCIRLMLGEEQNEAGT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.