NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005102

3300005102: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_1/10/2011_ DNA



Overview

Basic Information
IMG/M Taxon OID3300005102 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0055735 | Gp0103139 | Ga0056909
Sample NameWastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_1/10/2011_ DNA
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size279740073
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameWastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationMadison, Wisconsin, USA
CoordinatesLat. (o)43.076217Long. (o)-89.411742Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030790Metagenome / Metatranscriptome184Y
F097376Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0056909_1009387All Organisms → cellular organisms → Bacteria → Proteobacteria3064Open in IMG/M
Ga0056909_1010882All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium2728Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0056909_1009387Ga0056909_10093871F030790MRRALQYSTAVVATLAVLAIGQEARAAPLTLTQVPGGTVGPQSASLPCVIAATQCQQPAGMGFNNFTSSGAISSYNMYSTTPTANVADGVQGTPYTVAQIAGALGSLAFNIAIDVNTTAAAGETLQLFEVIVNGIVAYNFVGPTVIGGASSNGNGYADWTLSTVDLSSFAAGASVLFHAVWNHASDGGESFFLVPTSGTTIPEPRSLLIFGAGLLGLAALGQLYRRRRVEV*
Ga0056909_1010882Ga0056909_10108823F097376MKKAVSPKKNKTAADVVPQKKQTKTGPVELDLTELKKVSGGLPRGGWEKIK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.