| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005083 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114424 | Gp0111434 | Ga0068305 |
| Sample Name | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Queensland |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 731981760 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Termite Gut Microbial Communities From Australia |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Mastotermes Darwiniensis Gut → Termite Gut Microbial Communities From Australia |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | University of Queensland, Australia | |||||||
| Coordinates | Lat. (o) | -27.494746 | Long. (o) | 153.011858 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033480 | Metagenome | 177 | Y |
| F036964 | Metagenome / Metatranscriptome | 169 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0068305_10000408 | Not Available | 43536 | Open in IMG/M |
| Ga0068305_10004824 | Not Available | 27839 | Open in IMG/M |
| Ga0068305_10827624 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea | 779 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0068305_10000408 | Ga0068305_1000040811 | F036964 | MANHLKILFPALMVTGALGSLITNIAAKGDWRQSLQWLGASLLYTALLFRNQ* |
| Ga0068305_10004824 | Ga0068305_100048247 | F036964 | MISILKIVFPALMVTGALGSLIVNIIDNGFWATSLQWFGAMLLYTALLFRNSGGK* |
| Ga0068305_10827624 | Ga0068305_108276241 | F033480 | LLEFFWLLFLNKNSLLEEFFTGINIPFNCEFLVAQPDGHVVILTEVYRVRPTLPLQTYRFGNWTPDGGLTWPSQGFYHRRNNLQGHTIRATRVNVSRILSVYVKVKVVPKQ* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |