NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005080

3300005080: Combined Assembly of Gp0111534, Gp0111535, Gp0111536, Gp0111537, Gp0111539, Gp0111540, Gp0111541, Gp0111542, Gp0111543



Overview

Basic Information
IMG/M Taxon OID3300005080 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114457 | Gp0111534 | Ga0069611
Sample NameCombined Assembly of Gp0111534, Gp0111535, Gp0111536, Gp0111537, Gp0111539, Gp0111540, Gp0111541, Gp0111542, Gp0111543
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Michigan
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size655052089
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameActivated Sludge Wastewater Microbial Communities From Ann Arbor, Michigan, Usa
TypeEngineered
TaxonomyEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Bioreactor → Activated Sludge Wastewater Microbial Communities From Ann Arbor, Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationAnn Arbor, MI
CoordinatesLat. (o)42.293023Long. (o)-83.713393Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069722Metagenome / Metatranscriptome123Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0069611_10081870All Organisms → cellular organisms → Bacteria → Proteobacteria1176Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0069611_10081870Ga0069611_100818701F069722MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAALQER*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.